DPCstruct | MC11390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1CRI1 | 11-105 | DAFVCENCKLAVTPLTNGSYRNHCPRCLYCKHVDVVPGDRLATCQGLMEPVGVEYSPKKGWVILHRCTTCNELRRNKAALNDAEADD… |
| A0A4P6JSX4 | 34-134 | AGQDFKCKHCRRFIGPPPSGGYHRNHCPFCLYSCHVDDQHSGDRMSTCGAKMQPIGTFQRAKGEYVLVHRCLGCGFERFNRIAADDD… |
| H2CA66 | 289-382 | None |
| A0A354G3Z2 | 28-124 | None |
| A0A644ZUB3 | 41-155 | None |
| A0A2M7DDQ7 | 2-86 | None |
| A0A2E6NRP8 | 18-116 | None |
| A0A2M6WZF6 | 19-113 | None |
| K0K765 | 112-211 | None |
| A0A0G1Y8Z1 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.