DPCstruct | MC1139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 19.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4AQ67 | 2-108 | GCLGTFDFPAGFYVYVGSAQNNLERRIERHLRQEKKRRWHIDYLLHYGEVISVHTYAGERYMECVLSHKIGTMKDALSPVKGFGSSD… |
| A0A2E0CN76 | 4-112 | YQLKIKLNKKIKLQIGKLGEFLLKKGIYIYTGSAKKNIDSRIKRHLCNKKKLHWHIDYLLLNKNVKVIDVNKSNKFECDLNKETEGE… |
| A0A1G1HT83 | 9-142 | None |
| A0A2D5YJE8 | 35-170 | None |
| A6USW1 | 239-355 | None |
| A0A6N1VB35 | 28-161 | None |
| A0A5N9G5W4 | 33-165 | None |
| A0A2R6GH84 | 6-120 | None |
| A0A517XW54 | 280-416 | None |
| A0A521VC40 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.