DPCstruct | MC11388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 19.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6JR82 | 3-136 | AFQREVADRLGYQQHRYDALFDRGNPGMTSRELERLFAPIRETSMSLLRRIQDSHLRAETSFLTGNFAQEQQRALAEQLLLSIGFDF… |
| A0A0B0HKG7 | 7-144 | PYNTLLDLYEPGVTVDLLDDVFSKLRDHIVPLVQQIRESRHKPDTSFLFQPFPKEKQRAFSLALLKELGYDFDAGRLDETVHPFAIT… |
| W1EPZ9 | 1-136 | None |
| A0A535BWH0 | 75-223 | None |
| A0A090PJF8 | 132-266 | None |
| A0A4Q3VXI6 | 155-295 | None |
| Q4UKJ0 | 135-269 | None |
| A0A381GMU3 | 6-135 | None |
| A0A2A8MGG3 | 139-253 | None |
| A0A0G1UXL7 | 162-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.