DPCstruct | MC11385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 126 ± 7 aa |
| Standard deviation of domain lengths | 7.48 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 32.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4T1T0 | 101-232 | DSYYKTERQVTDTLSSLHDKREELFPNSLYILTGFMSGMVISRRRNILMKATAPIACGLLAFKIFLPSTFSNTFDFLKKLEKKNLPG… |
| A0A1S8BEM4 | 1-111 | MPGAIYVLVSAMAGSIVTRNRNILLRSTVPVAVGIVASWAILPLTTRNVGDLVWTYEERYPVIAENHLRAKERATRFVQTGIAHSKM… |
| A0A1B9H4X5 | 90-212 | None |
| A0A0E9NIP5 | 91-224 | None |
| I4Y5K0 | 67-186 | None |
| A0A165YBE4 | 52-181 | None |
| A0A060TI17 | 130-255 | None |
| A0A1Q3DXK5 | 458-581 | None |
| A0A3M6Y8H1 | 18-138 | None |
| A0A1Y2LRP1 | 231-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.