DPCstruct | MC11384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 338 ± 43 aa |
| Standard deviation of domain lengths | 42.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8NGL8 | 17-347 | RDPLPASLTQALILPDDARLTLSLPSNPEDGTHVVINDVPLCAYKSLARTVALVISAVGTPFENSAHHIPKYPVLELLPADQPKDIS… |
| A0A1S8BCQ9 | 1-345 | MSQSPSRETLPMQLTLPHPWHTTYTIKVGAYDEGLRQFQVQPTNSTTKPGHQQLHKEDLFWTEPKSSSPNTAPDGSSQESIPVSRIF… |
| A0A0F4YYD3 | 142-533 | None |
| A0A175W7R5 | 2-349 | None |
| Q2HC02 | 246-616 | None |
| J0WTS5 | 1-266 | None |
| A0A5M9LJX6 | 5-269 | None |
| A0A317AHY3 | 284-604 | None |
| A0A3N4LP65 | 62-382 | None |
| A0A1Q8KRS5 | 1-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.