DPCstruct | MC11381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 96 ± 19 aa |
| Standard deviation of domain lengths | 18.98 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2R8B6 | 46-131 | SGMPAGLMPLVSNNWTKLFTWQGVGPMPEAERTKLQAYVTDAHAKGYRVRFWATPDQPGAAREAVWNELFDAGVDHINTDDLEALE |
| A0A1S8B8C2 | 1-99 | MQPSSGPTLDRFNSTNSYYASVSFPKSVGRAHWLNGEPTAHQLHLVRGQIRGAKKRGLKPRYWGTPNWPIGIRNRMWEVLVEEGVGF… |
| A0A365NG21 | 133-210 | None |
| A0A218YRJ7 | 271-392 | None |
| A0A0F4YJY6 | 308-431 | None |
| A0A4Z0YQR0 | 184-305 | None |
| A0A7W1D477 | 2-83 | None |
| F4KZX7 | 567-643 | None |
| A0A0S7DLZ9 | 433-550 | None |
| A0A0S7E2I0 | 231-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.