DPCstruct | MC11380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 411 ± 63 aa |
| Standard deviation of domain lengths | 63.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 23.80 |
| Pfam Score | 88.24 |
| Assigned Pfam label(s) | PF10375- PF13851 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2GDU2 | 3-283 | VNDLSAELDMTKTQLDEMRSAMVTRDQEANQQLDAKEKTVVQLQRHVETLQGERDELEMHAMDLDARCHQIQEEYEANLAELTRCKK… |
| A0A1S8B6Z2 | 3-356 | QDAEELDRMRTQVDDLEDQNRQLRDDNEQLRKQTEEHASEISSLRSRATLSQQNWVKERDELIQREAYAREEFETAKQAMQDWEVLA… |
| A0A0H2S527 | 1-357 | None |
| J6EM82 | 21-435 | None |
| A0A0C9V577 | 16-404 | None |
| A0A1G4KF80 | 1-446 | None |
| A0A0L0TA08 | 48-355 | None |
| A0A2Z6NXS2 | 35-621 | None |
| S2JIT2 | 241-623 | None |
| A0A0C7NCK8 | 30-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.