DPCstruct | MC1138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 252 ± 29 aa |
| Standard deviation of domain lengths | 29.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537THF6 | 169-405 | VAIALLWPILTVAFGNPPVPARGSVSLVAYVIVTGALVLATWFLIFAVADTTLLTWRVINGLRMETGIWPPKTLKQFSDRLKLPADV… |
| A0A1V4AP69 | 56-329 | VAYLSAGYLFILKCGKPLIPFRGGISFYVDKCVLISSLLFMLILIMFVINVTWLCRNFIKEFVVTGLKNTVNIPKLLSARCSLEDDT… |
| A0A1M3NDK3 | 434-698 | None |
| A0A537T9G3 | 2-234 | None |
| D8NI37 | 5-224 | None |
| A0A2E8EUN1 | 55-295 | None |
| A0A7W1Z472 | 319-550 | None |
| A0A286TTZ4 | 548-874 | None |
| A0A3A6RQS4 | 959-1212 | None |
| A0A5E7GVC9 | 423-658 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.