DPCstruct | MC11379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 79 ± 17 aa |
| Standard deviation of domain lengths | 16.99 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 43.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8B6B3 | 1-83 | MGWWGNLGSLPQKGVTSYGLSNNRQKPLGGAFHNAIFNTFRRTRQQILFWAPPMIAGYSIMQWAIENNEYYNGKEGRALMGDE |
| A0A4S8V7V7 | 24-78 | QRGIITYAMAQNRQRALAGAAHAAVFNTYRRTKGQILYWAVPMLIGYELMNWATE |
| A0A842ZG67 | 11-69 | None |
| M9LQJ6 | 131-252 | None |
| A0A4S9KKB3 | 1-60 | None |
| A0A059J298 | 1-73 | None |
| A0A1E3JPJ6 | 1-74 | None |
| A0A2G5BGW4 | 2-88 | None |
| W9YGT4 | 23-82 | None |
| I4YGJ9 | 11-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.