DPCstruct | MC11375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 138 ± 16 aa |
| Standard deviation of domain lengths | 16.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5MLV6 | 237-383 | TIDAQYDTELGIFETETSTVMWGISRSKGKFAPLVCRERQTRSQAMDYVAKELPVILPKSIVTYDELTPGWEEIKKTLPDVVDAVSS… |
| F9PRI8 | 6-133 | NFGVKRSNFNWIFKGILSNYSHDNFVSSEIDLDLIPNVDIFSNKSSKISKLKVKEKVQNVLDYFVSPDENLIVILTADDISMYEIKN… |
| A0A7X8YRN2 | 1-120 | None |
| A0A7X8MSD6 | 67-227 | None |
| A0A0L6JWD9 | 403-548 | None |
| A0A7Y5TVL5 | 210-366 | None |
| B6W874 | 125-270 | None |
| A0A1F8UC98 | 23-156 | None |
| A0A7T6VP35 | 9-106 | None |
| A0A7V6P2N3 | 37-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.