DPCstruct | MC11374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 197 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 25.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S8UYW8 | 1-183 | MKENLNLACQKQHDASTASSDSFLLLAAKKNDRDVCQTHEKAILSEFLNAVPKQHQFHKPLLKVFSKKLKRSKKNISGNTSEDETNE… |
| A0A6I8NLG9 | 146-336 | VEQEILKREEIRNLYLQEHLNRRWKLEDFLSEMEDKKLEMTRLQDQEKALYASFQASLGENNSFASFLTKVLKKKIKRVKKKETEGD… |
| A0A3P7LN29 | 2-166 | None |
| B4Q353 | 227-446 | None |
| A0A4Y2IWE5 | 36-221 | None |
| A0A7S0AGE2 | 77-295 | None |
| A0A3P8GUF6 | 82-304 | None |
| D0P440 | 41-223 | None |
| A0A4C1XKY6 | 2-183 | None |
| S8ERJ9 | 438-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.