DPCstruct | MC11373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 157 ± 21 aa |
| Standard deviation of domain lengths | 21.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.05 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF06905- PF00787 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4EFP4 | 2-118 | YRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVGEDTFHIDQTRCIIRVDPAPGFKYEYSLYIDGKSHEQYTEDMTRQYRLWLYTCD… |
| A0A6I8NL27 | 114-272 | DLVAVWEVALSDGVHKIEFEHGTTSGKRVVYVDGKEAIRREWLFKLVGKETFRVGAAQTKASISIDAVSGFAYEYTLEIDGKSLKKH… |
| G0MWN2 | 15-193 | None |
| G0MWQ3 | 30-191 | None |
| A0A3P7J432 | 58-256 | None |
| A0A5J4NH75 | 2-108 | None |
| A0A556TTD4 | 3-172 | None |
| A0A482VBC7 | 267-431 | None |
| A0A821QSV6 | 439-570 | None |
| A0A2G5TV54 | 3-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.