DPCstruct | MC11371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 151 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5MJT3 | 65-203 | PSVLQHCEEIHNEVEFQWLRQYWFQGRRYEKFCSWWRKPMEELEEAWRKMEIMTQLALAEAEDAARTMERRREVAQVLLPFLTERQE… |
| A0A6I8NBT7 | 17-155 | PAVVKRGEEIHNEVEFEWLRQFWFQGSRYSSCTDWWLQPMTHLEGLWEKMEHMTKAVLRAVRKEEQPTEQKNEIVTCLLAPLTERQE… |
| A0A397A3Y6 | 2-144 | None |
| A0A7R9Y7A4 | 258-439 | None |
| A0A7J8CGB2 | 155-298 | None |
| A0A6G0WHV1 | 355-509 | None |
| A0A0D2UDP8 | 479-631 | None |
| A0A835ZL97 | 323-476 | None |
| A0A1Y5I0Q0 | 543-687 | None |
| A0A813I311 | 732-883 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.