DPCstruct | MC11370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 253 |
|---|---|
| Mean domain length (aa) | 299 ± 64 aa |
| Standard deviation of domain lengths | 64.12 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.33 |
| Pfam Score | 75.20 |
| Assigned Pfam label(s) | CL0022- CL0203- CL0220- PF00746- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401ITR7 | 135-413 | KTALSAKIQEANKYLYTNGVYTKASLENLRIAVQRGNGVIKSDAASQQDIYNAIARISQAINGLQRISGQEVNKQPLEAKLQEANKY… |
| A0A7Z7W1Z7 | 58-279 | NTGTQLNTAMANLQNGINDKTNTLASENYHDADSDKKTAYTQAVTNAENILNKNSGSNLDKAAVENALSQVTNAKGALNGNHNLEQA… |
| B1C545 | 748-981 | None |
| A0A355G0N9 | 700-999 | None |
| A0A150NTE4 | 726-989 | None |
| A0A373KN70 | 32-265 | None |
| A0A2S8PFR1 | 53-299 | None |
| A0A4R3Z0V9 | 716-941 | None |
| A0A0J1G839 | 446-735 | None |
| D4XUY2 | 425-688 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.