DPCstruct | MC11368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 200 ± 18 aa |
| Standard deviation of domain lengths | 17.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7K7K7 | 279-477 | RPAALVVIQDFVVGAAENREAVTEAFTQLDIPIIKAIRLTERSATQWRLSPEGLPVDSVQYRVALPELQGIGQPIVVSAVGASRIDP… |
| A0A1J5EC92 | 1-220 | MPVYGYPSQPVIERFFFDMDGKARVRLVVGIAMKLGLNPQVGIPLLTRLNVPVINAISLYTQSRQEWERSKVGLDIFERTWQVATTE… |
| W4U3Q9 | 5-217 | None |
| A0A179D5F6 | 229-442 | None |
| A0A7V0JTZ9 | 2-209 | None |
| A0A843DZZ9 | 58-282 | None |
| D9PWQ2 | 171-368 | None |
| A0A090T6Z7 | 65-256 | None |
| A0A7W1GJ31 | 1-194 | None |
| W4TWM9 | 19-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.