DPCstruct | MC11364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1VVM1 | 145-238 | MSGTAFGTVFLHVSPESADGGTLALVQNGDLIEVDVANKYLHLHVGQDELDKRRADWKAPDLGYHRGYINHYIKHVQQADQGADLDF… |
| A0A7Y8UYL5 | 35-117 | GSRGFVVGHVAPEAQVGGPIAYLQTGDIVTIDSQTQEISFQITEEELNRRQDHWIQPKLKASSGALGKYARLVSPASKGAVTD |
| A0A7S4E837 | 520-616 | None |
| R9P8I1 | 685-786 | None |
| A0A3D5DRB6 | 143-233 | None |
| A0A2S4KRI7 | 6-101 | None |
| R6HIP7 | 121-207 | None |
| A0A0M9F6J5 | 483-596 | None |
| H0ESC2 | 382-464 | None |
| A0A1V5ZGU5 | 358-449 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.