DPCstruct | MC11363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 226 ± 33 aa |
| Standard deviation of domain lengths | 33.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0MWA5 | 183-362 | KAERQVVKKYVDKLDRLKSTLTTNTADGTIEVDDLRFQLGWTRLLNRKYAFQTLVDFWFVGDKANLQEEISELALLLRHPEFTRHAK… |
| A0A0C4FA22 | 1-210 | MNPSSEDITSPEDRNLHRTTPAFMLADFVGLEVTQVEKYINDLAQAFARLPPNTSPESRDFGWNLALSCDVDVLQTGWETDDELTEE… |
| A0A5B0RNM9 | 1-199 | None |
| A0A0L0VPS0 | 2-221 | None |
| A0A0L0VVH1 | 1-258 | None |
| A0A2N5SDT8 | 3-206 | None |
| A0A2S4WA20 | 3-175 | None |
| E3JVT2 | 7-232 | None |
| A0A180GAG3 | 194-421 | None |
| A0A2N5VUR9 | 1-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.