DPCstruct | MC11362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 143 ± 13 aa |
| Standard deviation of domain lengths | 13.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A180G2T9 | 230-358 | LTEAQLAIDAKKYSKKAMSDADRAFFAEFYHKQRKELCVQAIERGVSLPMVDAYLGKQMPVKKPNRFNHFMRTKRARAVFRGRCEEQ… |
| A0A2N5S2B5 | 122-256 | LSVIELCKIAQDYSKQSMSEEDEEFFLALHQEQEKQQAIKAIERGISLSMVFALLGRRIAVKEANHWNRFLQTDQARLIFQESGLGV… |
| A0A2N5UYZ6 | 1-124 | None |
| A0A180GRA7 | 76-235 | None |
| A0A2N5VIR5 | 52-197 | None |
| A0A2N5W5A3 | 1-130 | None |
| E3JZP6 | 54-202 | None |
| A0A2N5RW20 | 545-705 | None |
| E3L0W1 | 220-350 | None |
| A0A2N5TCH1 | 182-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.