DPCstruct | MC11361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 194 ± 32 aa |
| Standard deviation of domain lengths | 31.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.80 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0039- PF01871 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0CUW7 | 1-195 | MNITDIDDKIIKRARQNHLLDEYLACERSLEDLLQDYEKVLVAFKGTLEKTVDEEKKTMLQNLRQRMTDSLDALTEAIKSADAGKVN… |
| A0A0C4EZ39 | 1-198 | MNVTDIDDKIIQRARQQHLLDNLRTELSTLTQELVGQVRQSLEAYQRNTTSKLLGDQSADIEQLLQKAAREPGWKAEMVAREEKFGM… |
| W6LAN3 | 420-603 | None |
| R7TMX3 | 13-180 | None |
| A0A084RTR0 | 66-273 | None |
| A0A812N6P0 | 531-712 | None |
| A0A0K0D4L6 | 95-272 | None |
| A0A7J7QGE4 | 86-269 | None |
| T1GS44 | 30-179 | None |
| B8N801 | 2-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.