DPCstruct | MC11360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 215 ± 32 aa |
| Standard deviation of domain lengths | 31.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7X4T6 | 111-316 | ALWLYCGAHGMRVWLPLFPRHGDSAHTFMSKRIMLPFQLKIYPLAILFEDAILLGAENDTLLYTSDSNSPFSLPFCVLERTSQVYLH… |
| A0A0C4EY99 | 22-270 | VQQRTRIKPALAFALFSLVTHTELFIQHVVAACLRRDRMDEAVQVGTCYASLAYFGHALEKLLHGAIEAAASQRPRPTDGEERADDG… |
| A0A653C304 | 23-252 | None |
| A0A813V5L3 | 321-509 | None |
| A0A2D4EMV0 | 104-318 | None |
| A0A1S8VLA6 | 185-350 | None |
| A0A7S3V0I3 | 185-466 | None |
| A0A433DIZ6 | 323-558 | None |
| Q2U2H6 | 1-207 | None |
| A0A0N0U6N7 | 255-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.