DPCstruct | MC11359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 152 ± 24 aa |
| Standard deviation of domain lengths | 23.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C4EY66 | 1-118 | MSKIKLTKHLVKEHIKLWQECAKSQPHGASEELRALLRKAQESQKSCQKIMKQHELEAHVQGWNPWTVMKFMFPAKNGDKGKKRSST… |
| A0A0C4EY05 | 4-139 | QAVIRVYPGPSTATHEDQEIRILSQEERIRLYVHEHVAIWKKCVALQPLGASKELKTLLRQAQQSQRDLQKHISRKEVEGYVQGWNP… |
| A0A2S4ULG1 | 146-337 | None |
| A0A180GBR7 | 259-430 | None |
| A0A180G3H5 | 39-206 | None |
| A0A2N5V0R6 | 486-647 | None |
| A0A2S4WEZ3 | 221-364 | None |
| A0A0L0VHU1 | 2-108 | None |
| A0A5B0R316 | 24-156 | None |
| A0A0C4F887 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.