DPCstruct | MC11356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 139 ± 25 aa |
| Standard deviation of domain lengths | 24.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821L5I4 | 1-108 | MNVPADNVKIQTTLRQLEQPMCLFGEGPAERRKRLQNLISSLSDNEIAKILPWYHDGPDELQTVRYWIAEYSLSRAKERIEKLKEYV… |
| A0A0C4EJT3 | 2-175 | EVDFDDLVTKQFDPNDPNQTRTQAEHAALLTSLDRATRSRQLAVPTNEVAIRVRLRELGEPMTLFGERPEDRRDRLRYVLSQIAEAK… |
| W2T3T4 | 28-184 | None |
| A0A812IQG1 | 2-105 | None |
| H0ERL8 | 533-665 | None |
| A0A4Y9Y8V8 | 3-162 | None |
| A0A183R482 | 1-189 | None |
| A0A821UCN2 | 9-122 | None |
| A0A1X7SFZ7 | 12-144 | None |
| L2G8P9 | 417-558 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.