DPCstruct | MC11355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 2 aa |
| Standard deviation of domain lengths | 1.62 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 95.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 62.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9R9P5 | 242-322 | RTYNSGQFWQDYVTYVRVARDMAGKYGIPLTLDAGGAGTRGIKSHYWVTKNIWGDHVDPYGYLSRFGVTQAKLAHDLLYGV |
| Q1WS09 | 557-636 | RTYNSGQFWQDYVTYVRLARDMAGKYGIPLTLDAGGAGTRGIKSHYWVTKNIWGDHVDPYGYLSRFGVTQAKLAHDLLYG |
| A0A0R2H2Y4 | 685-764 | None |
| A0A0R1P3I6 | 187-267 | None |
| A0A829GQ46 | 48-132 | None |
| A0A6B8G470 | 289-367 | None |
| A0A0R1SRI3 | 352-432 | None |
| M5J5H4 | 972-1052 | None |
| A0A0F7PVI1 | 382-461 | None |
| A0A808WRI7 | 463-541 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.