DPCstruct | MC11354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 329 ± 66 aa |
| Standard deviation of domain lengths | 65.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4L2K2 | 71-489 | LKTAEAEDAHSELARVGPAERLELLADVLPEDPAELWEPGGMRPVAERLAEAWRARYGRRTMVPERTFGAVVEMRPFPLTAGRFCAA… |
| J1GU17 | 7-338 | REDDGSFHLPGHLLDEAGRAFRYGGRAALLGLGGSPDEQNLDAWLWAAALAHRDDPLAGWLADAYESMKRACATTPLTWSVYDRGAA… |
| A0A550HFJ9 | 412-788 | None |
| A0A8A9ANX4 | 245-598 | None |
| A0A1P8TAY8 | 3-416 | None |
| A0A3N4SRQ8 | 890-1259 | None |
| A0A347PYS0 | 480-802 | None |
| A0A0N1GD40 | 30-253 | None |
| A0A562DAZ9 | 314-710 | None |
| A0A8B4HA42 | 2-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.