DPCstruct | MC11352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2194 |
|---|---|
| Mean domain length (aa) | 148 ± 25 aa |
| Standard deviation of domain lengths | 25.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.36 |
| Pfam Score | 89.49 |
| Assigned Pfam label(s) | CL0489- CL0003- CL0652- PF20636- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445N4A5 | 18-168 | SIFDQAVSSQDTWEMYLHKFRVIKAKLIENLKYDIKIEIKDLGNEVIPKVNIKMLYPLTQAETVSGLIKTDDKVKDLNLEPILAPAK… |
| A0A1S7LFB9 | 10-145 | VVKRSLKNRQHIRYYTEKDNIETSARVLKVGAKYAEVEDLEGGACWKVPFYMINLQGVEVDIHVSEPGVKLDKNLLKNGEFVGFFDN… |
| A0A3L7PM48 | 109-231 | None |
| A0A068V5I9 | 72-206 | None |
| A0A6D2HLC0 | 3-140 | None |
| A0A068V7W8 | 75-190 | None |
| A0A810LB07 | 3-161 | None |
| A0A0E0H906 | 225-364 | None |
| A0A1G4T7K9 | 61-205 | None |
| A0A3S1A6C3 | 161-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.