DPCstruct | MC11350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1941 |
|---|---|
| Mean domain length (aa) | 89 ± 20 aa |
| Standard deviation of domain lengths | 19.86 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 98.70 |
| Assigned Pfam label(s) | CL0290- CL0183- CL0123- CL0505- PF08523 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6ITQ2 | 8-73 | INLIKTGENIKKLRIKSNMSVKDLQMHLGFDSPQAIYKWQWGQCLPSIDNLVALAKLFNVTIDQIL |
| A0A0R1RLK7 | 7-88 | QITEFSKKLVELRKTANFSQDELAEKIFLSRQSISKWENGESVPDMNNLVQLAKVLEVSLDELVLGVEPVNSQSRLMKEFLD |
| A0A522XGR4 | 75-245 | None |
| A0A830Y685 | 1-84 | None |
| A0A844YXC2 | 1-81 | None |
| A0A389M4A3 | 9-101 | None |
| A0A3B9FYU0 | 92-183 | None |
| A0A1X7NYP7 | 1-102 | None |
| S7HRW8 | 2-68 | None |
| F1W4W1 | 3-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.