DPCstruct | MC1135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174TPL3 | 1-75 | MKFYFTYGTDGQPFVGGWTEVEAPTARAAAFAFRTFHPDKTEGLLNCSDMYPQAVFERTEMFQEGNFGHRCRETI |
| A0A416R1W7 | 1-72 | MNNFYFTFGSDPIFPYYRGYLIVKATNEEEAFEKFRNKYPDTHPGCLCCAFWYTQKKWDKIEVDMETCHEII |
| A0A3D5LQ65 | 1-77 | None |
| A0A0Q4BHB5 | 27-104 | None |
| A0A7C6PQJ5 | 1-83 | None |
| R6LQP6 | 3-85 | None |
| A0A2P8EHZ1 | 1-96 | None |
| A0A3A9CYY3 | 108-184 | None |
| A0A1G4WR01 | 1-79 | None |
| A0A1Z2XTS7 | 113-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.