DPCstruct | MC11348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 175 ± 21 aa |
| Standard deviation of domain lengths | 21.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0EBL0 | 313-484 | VFANIGSDGANNVIGVTAQGNRNTLKGNIFVDCSATFLGWNSYAPGATWDMTKTEEKERVELAEKYAANPIFAAKYPELATFKDEYY… |
| A0A836XD66 | 3-154 | TSASSTTTVIGGGRDCVFENNVYVDCTPCVHVDARAMNWAAYHVATTMKQRLDEMPIQDPVRARKYPELLTLWEDDPAAPKGNIIRY… |
| A0A7X6ZFN1 | 124-290 | None |
| A0A7X6YFG6 | 211-417 | None |
| A0A7V7D7U5 | 544-718 | None |
| A0A7X7IXL4 | 343-559 | None |
| A0A3D4ZXE8 | 98-264 | None |
| A0A7C3XA97 | 759-907 | None |
| A0A7V4TA43 | 17-176 | None |
| A0A7X7AYH7 | 1031-1187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.