DPCstruct | MC11344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836TWE0 | 3-83 | YEQHYLHALVAPRHLLVTEAYEDPGASPPGSYASCQVARRVYDFLGSPDAVGWAFREGGHSHQVDDYAALLAFMDRVFHGR |
| A0A7C3YHP6 | 6-100 | LPFDQHELIALIAPRPVYVASAEEDLWADPLGEFLSARHADPVYRLLGTEGIATYKMPEIEQPIMSIIGYHIRHGKHAVTEYDWEQF… |
| A0A2E9IMT3 | 345-426 | None |
| A0A7X7FFK2 | 72-153 | None |
| A0A7X7YUI9 | 44-147 | None |
| A0A354TCM3 | 258-357 | None |
| A0A0S7DE03 | 669-776 | None |
| A0A146HKR8 | 393-507 | None |
| A0A1H3XKS3 | 168-251 | None |
| A0A3B0AUH8 | 157-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.