DPCstruct | MC11343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 299 ± 29 aa |
| Standard deviation of domain lengths | 29.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z2STA7 | 25-309 | LYMPIIGPFMIFVLPVPFAYYAHRHGWKPGALVFLVALIFSLLFATVISPVTLLAGIGGLFLGGAMHKKRGSYETLAIGSVGFIIGI… |
| A0A1Y3UCQ4 | 24-341 | ASRPSGGWLWFVGIGLSVAVMARYPMLGVACLAMGLRTQSERFGAKGLVAGLGISGAVLVAWMVLDGVSNVLFAVPLVGIAAAISAL… |
| A0A367ZMJ6 | 16-335 | None |
| A0A377GXA4 | 2-255 | None |
| A0A6B0X6L2 | 3-270 | None |
| A0A350MTI1 | 34-352 | None |
| A0A1V5PQJ6 | 7-323 | None |
| A0A2N1PSA8 | 74-438 | None |
| C6HX93 | 5-321 | None |
| A0A7Y2B2H6 | 2-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.