DPCstruct | MC11341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 665 ± 106 aa |
| Standard deviation of domain lengths | 105.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.55 |
| Pfam Score | 86.01 |
| Assigned Pfam label(s) | CL0179- CL0243- PF13298- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0PYZ6 | 17-838 | EPRGTVAQPAERLAFFVQKHAARRLHYDFRLELEGTLKSWAVPKGPSLDPHEKRLAVQVEDHPLDYGDFEGTIPPRQYGAGSVLLWD… |
| A0A7H8S7S0 | 1-584 | MRLMKPIASDETPGSEEWAYEVKYDGFRCVLHWEDDSIRLVSRNDVDLSSNFPEIIEACQAQQPLVKKVLPLKIDGELVVLNNAYQA… |
| A0A1E3W871 | 1-619 | None |
| A0A3P0X3T9 | 259-1155 | None |
| A0A1Q7TNB5 | 29-658 | None |
| A0A538KTD2 | 139-814 | None |
| A0A7Y5WN93 | 249-1017 | None |
| A0A5N7YG36 | 479-1117 | None |
| A0A534NDN4 | 58-590 | None |
| A0A5C8PTB5 | 19-832 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.