DPCstruct | MC1134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 136 ± 13 aa |
| Standard deviation of domain lengths | 12.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8Q3K8 | 4-147 | DPSDEHPDFRAALEVFSRDLRLAEITHALGREPDRERSRDVGDPLLQPGAPPRSSAAWRLELEFDRVVHRGCHGLSMALRDLGYDLA… |
| A0A4Q3EUX8 | 87-216 | YHAVYLKVNSRELSFDELAAMTKLKSTGGWNKGDTIKNLKVPQRWSAFFVESNPEPDEFERKLDKLLSVLETDIEGLVTLKANATTW… |
| A0A534MUL0 | 2-132 | None |
| A0A5C7XIP9 | 3-144 | None |
| A0A2N9YGG9 | 222-359 | None |
| A0A345ZHL5 | 1-102 | None |
| A0A2I9D487 | 32-184 | None |
| A0A163VWU8 | 106-247 | None |
| A0A518HML3 | 122-267 | None |
| A0A1T4XTT9 | 31-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.