DPCstruct | MC11337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 146 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848S8Q3 | 1-116 | MLHELHKVGYQRLRADMGMSPSGMHWRCKIFVVDRPGIEPAYYTSADKTNYYRWTDADQDTARQMAAKFIYRFPELCEAGTGLDFAN… |
| A0A3G8Y3V6 | 3-128 | KLLHLAGELHRKGYTGLQVIPSLSPSCVYWRCDFTNADSSERLSVSNWLQENFDIKEKEASTTEIVKRFEEDYNHFLLGSQGKDEYY… |
| M7MU35 | 6-161 | None |
| A0A7C9KX95 | 2-152 | None |
| A0A6G6W9Y9 | 298-459 | None |
| A0A2M6V8J6 | 353-499 | None |
| H5YLL9 | 8-173 | None |
| A0A2D5S7U2 | 148-308 | None |
| A0A220UCP8 | 2-129 | None |
| A0A6L6FYH6 | 14-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.