DPCstruct | MC11333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402G3V5 | 2-83 | NIDYCPKCGHAKLKHLLCGYCYKKIRHESSIIKAQIKAQEGGPHRAPTVETVVLYTGEKPREQDEGKRIIERTRKRPSWFPL |
| Q307P1 | 1-96 | MLVPQTNIKVCHECGHHHERGRLCEHCYKRVEEETKLIQTRIKHKLGSGPIQDDVIVLYKGENLPEKAQEFWKGKRVIEMKKERPQW… |
| A0A132A898 | 95-194 | None |
| A0A0B1SKX5 | 591-696 | None |
| A0A0P4W950 | 110-210 | None |
| A0A5K3FIL6 | 1-83 | None |
| A0A0N4V877 | 15-121 | None |
| A0A672SWP9 | 18-112 | None |
| A0A443R8K3 | 75-172 | None |
| A0A4Z2EGC0 | 49-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.