DPCstruct | MC11330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 225 ± 28 aa |
| Standard deviation of domain lengths | 28.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 14.47 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF07196- PF02465- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7ZL81 | 127-338 | DDGPATLLSTQAGPYDLTGEGNGGTIIVNPDGDGAKTVTINFAAGKHEGGTDCSIDMTGEVDTKLKIRANGDPDWHEITCDWTLCNS… |
| A0A2S1GY61 | 1-293 | MTVTTAPTKVKYLTTDTSLDLSDLIVTATKSDSTTAVVNAGDLQVLPVDFTTVGTKMITVTYEGKTATFDIIVEEPINYSSKTIQSL… |
| A0A0F9NRH5 | 384-605 | None |
| A0A2E5HNM9 | 77-289 | None |
| A0A6G7R6R7 | 433-691 | None |
| Q1MRV9 | 79-305 | None |
| A0A4R0WML2 | 124-308 | None |
| A0A0G0CPW3 | 47-295 | None |
| A0A0K9YTA6 | 28-230 | None |
| A0A369W6Q8 | 26-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.