DPCstruct | MC1133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 153 ± 16 aa |
| Standard deviation of domain lengths | 16.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0Q2E0 | 39-190 | VKTQAVALDQLLADSGDSRSAVVGAVEDVRKCVKLDAAAQALRGAAQQRADLVTRLNELEVDRLPHHAELTAALTKAWQASKSADEH… |
| A0A4V2XP45 | 52-201 | ARGQAEDLDALLTWNTGTRDTVAEAVQSLLACPDVPPDQLAEAKETFMEAADDRTTRLESLDALALDELADGDGLERALREAWGASA… |
| A0A7X7QDA6 | 634-779 | None |
| A0A5S4EXJ0 | 4-139 | None |
| A0A1H6DLI1 | 400-561 | None |
| S4MVG5 | 2-129 | None |
| A0A1Q4XZI6 | 160-322 | None |
| G8SKQ8 | 123-285 | None |
| A0A1M6MKI2 | 600-752 | None |
| A0A239F7J8 | 90-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.