DPCstruct | MC11328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9YHM1 | 105-208 | TNGGLKVAVENGEVKILQEGKSNKFVKSVDQVTFNGEYATKMHKNVWYITERCVFKLTDKGLKLTEVAPGVNVEKDILAHMDFKPIV… |
| R7D8Y4 | 1-89 | MTFNAKGLEVTQEKGVVTIHKEGEISKFVEKVSSVSFSAKRAIENGQKVLYVTERCVFRLTPKGLKLIEVYPGVDMKKDIIDRLPFE… |
| A0A531L151 | 709-819 | None |
| A0A536BRS9 | 174-280 | None |
| A0A238J544 | 252-357 | None |
| A0A1Q9CT41 | 1029-1130 | None |
| A0A844AVS4 | 98-205 | None |
| A0A7S3PPC5 | 166-285 | None |
| E0E126 | 1-108 | None |
| A0A3D0SQ53 | 104-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.