DPCstruct | MC11327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 151 ± 40 aa |
| Standard deviation of domain lengths | 40.29 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 93.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.58 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0105- PF02610 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7D735 | 12-156 | TAVLDWNNNYGDAEDKLILFHCGSCAQSLMTKKGTVTSHKMFDKGDPGSGWGTNEGRIHPFKTTISNCLTVDGKIKIYASEAEFTDD… |
| A0A379BFH2 | 150-398 | LPNGDFMEAMLNSTYDWNGVRPPYILATENDSLNGVNMLFGNQLTGQAQVFADVRTYWSEDAVERVTGFRPETGFIHLINSGSAALD… |
| A0A7V7DVI6 | 142-386 | None |
| A0A0U3DYE4 | 247-368 | None |
| A0A3A4P947 | 290-496 | None |
| A0A350SHM4 | 75-195 | None |
| A0A133VN75 | 60-227 | None |
| A0A496SKS3 | 2-112 | None |
| A0A7C5NN23 | 99-247 | None |
| L1L5M4 | 319-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.