DPCstruct | MC11326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A6NQJ5 | 9-98 | VYYTDVCIGWIAARAGVPHESDQWAWSCGFYPGAPQHAERDGTAVDFEQARARFEVAWRDLAGVLTETNLQEWRDQRDWTERKYAMW… |
| A0A1G8YPU0 | 1-96 | MIFGDVHVGTIGLRSGNPTDTDPWQWRCGFYPGSDPGEATSGTAATFESARAAFEAAWAIFLPQRTDADFEARRQERDWTARKYAAW… |
| A0A160UP37 | 1-101 | None |
| A0A1M7UKR5 | 8-86 | None |
| M4Z2G5 | 20-95 | None |
| A0A1G7Q6T4 | 19-110 | None |
| A0A560E2P7 | 34-115 | None |
| A0A0E4FZM5 | 1-74 | None |
| A0A7Y6W1V6 | 26-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.