DPCstruct | MC11324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N6JTG0 | 98-182 | ENVPDDVRTWFKGVRSPAGVPCCDISDGHRTEYDVRAGAYWVPINGLWWQVPEKAIIRNAGNPLGEAVVWYVSLRGNIEIRCFVP |
| A0A1G8VNC9 | 19-117 | ISTIGQARAHDHQHPELNSWYESLYSGKGPCCDGSDAKRVDDADWNTKDGHYRVRIDGEWIDVPNDAVVDGPNRAGRTMVWPYYLNG… |
| A0A1Q7BC33 | 1-126 | None |
| A0A2T0PH69 | 98-207 | None |
| A0A2U8PIY9 | 27-166 | None |
| A0A5C7PMY8 | 1-102 | None |
| A0A363TMI8 | 22-144 | None |
| A0A259MP93 | 14-142 | None |
| A0A7R6XV35 | 64-160 | None |
| A0A537N0D9 | 27-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.