DPCstruct | MC1132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7BUG1 | 163-263 | GTVSDGYHTHRELYEYRMLYNAHAAHGWLAAGIPVVKSRRHSDGEECFGGGWFIVTATLPTGQVSNHYRDEHWGLFDVPAVELPPEY… |
| A0A4R4P6Y5 | 9-114 | LRDAIRRRLAPPPSPADTVYEERAHLLALLAAHHHAVITDAQDMPPGWLLLHLTLAGRPLTWHIHPRDQALFAAVERVPASDPRAQW… |
| A0A100J2Y5 | 8-127 | None |
| A0A511MXL5 | 34-133 | None |
| A0A4S5ES56 | 3-91 | None |
| A0A2W1TXZ3 | 17-133 | None |
| A0A7V2PED4 | 9-104 | None |
| A0A1F3T3Z6 | 53-152 | None |
| A0A843FEN9 | 140-258 | None |
| A0A7Z0PRF8 | 5-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.