DPCstruct | MC11316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 9.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q6YW23 | 67-156 | AMLEIIGIVPATEGGFYVREAAFYTEDDQAFAIVKYPETYKPSIEDNASAELGIKAVIDVVQSEMVNLKIDPSMVYATQDYVNNEIN… |
| A0A6L3MDH6 | 8-91 | QINPADEGGRWIREIGLYDADGDLVAVANCAPSYKPALSQGSGRTRVVRMNFIVASTGNITLKIDPAVVLATREYVEQRIMEEL |
| A0A3S8ZPY2 | 64-155 | None |
| A0A1W2CWK0 | 1-84 | None |
| A0A5P9CSZ5 | 2-100 | None |
| A0A7I0L7S4 | 65-154 | None |
| A0A1E7WJE2 | 74-160 | None |
| A0A506K1B3 | 66-155 | None |
| N8RAV5 | 62-162 | None |
| W6W1A8 | 54-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.