DPCstruct | MC11315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 231 ± 37 aa |
| Standard deviation of domain lengths | 36.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5THL0 | 77-320 | MIGQDITPITTDRGYIEAKLTALNPNFSAVIVEMLNEAGVNQGDNVAVAFTGSIPGLNICVISALQTLKLNPIIITSVGSSNWGAND… |
| A0A7X7DV65 | 41-299 | IGIEWSPVTTTLGPIEAKRTAADPLWSVYALREFRKFGLKEGETIAMISSSSFPGLVYSLLAAAEHLGLRVLWIHSLGASTWGANIP… |
| A0A533YR33 | 605-878 | None |
| X1BZA9 | 3-181 | None |
| A0A7X8LDW8 | 63-259 | None |
| A0A496PXY5 | 108-350 | None |
| A0A2E3G443 | 45-342 | None |
| A0A3M1CYP5 | 8-193 | None |
| A0A644ZVN3 | 35-269 | None |
| A0A1Y1RG94 | 18-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.