DPCstruct | MC11314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 449 ± 87 aa |
| Standard deviation of domain lengths | 87.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7DUX7 | 3-459 | NTETGKTMLSKFAQRTAWMGPAAMNRLSRLTGMEERQIRDLASWTWKELTKERRLWGNRAAAQAGAAGGNFAGSQAGQAAKRNAEKR… |
| A0A1G1M9K4 | 38-367 | DPAKQAAWETAQAEAAKRIADFDAAVKTGKPERIRKAGLNLQSDPMAVQKLNQAGRTDLIEAHNQVTEKIKTGAKENIRENMAKEWN… |
| A0A367WSU3 | 503-935 | None |
| W8KU82 | 404-917 | None |
| A0A7V3AET3 | 665-1217 | None |
| A0A7X8KYT6 | 732-1191 | None |
| A0A7X8U1X9 | 109-486 | None |
| A0A2E3S440 | 610-963 | None |
| A0A7Y0AXV3 | 345-785 | None |
| A0A1V5KIE9 | 2-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.