DPCstruct | MC11313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 222 ± 26 aa |
| Standard deviation of domain lengths | 25.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 38.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A074YLI9 | 74-290 | MKAPSAIALKARHRRLCRTCIKAPLDSHLRITPPDTENDHRSQTSHSSSTQPLYRDPCTCSSHIWICSPCGTTLRTHDTSYTRAWTW… |
| A0A2H3IPW1 | 10-215 | QQTKHAFTFSAFARTPCRCEDTLWLCESCGLALGKNDSTYRRVWTWRTRYGAYLGTGLGTGIGEGCQGVKCGKGEECLAASAIELEV… |
| A0A0S6XJR3 | 3-175 | None |
| A0A507QLS4 | 15-240 | None |
| A0A6A6P4L1 | 324-573 | None |
| A0A5N5MHH6 | 109-360 | None |
| A0A3M7LZ87 | 9-232 | None |
| A0A4V5N762 | 37-246 | None |
| M3D978 | 130-367 | None |
| A0A0B1P425 | 50-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.