DPCstruct | MC11311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 138 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L2G2J1 | 142-284 | SRCLLELTSLIEVAPYTPMWMLVGIPITGFFVLFDLVIHNPKGQQVASNLALLDMVVGHASQLEYVSQGVIPGSIIGEFAHIARTYV… |
| A0A5N6XSJ9 | 304-424 | TPFFVMIFMPLTALFILFDLVIHYPAHPDARSNIVLLESVTGYFSALEYATSGYLPGSMLIQFSSIARIFHSSSHPAHVEDINNGNN… |
| A0A505I0M2 | 715-861 | None |
| G7XTI4 | 89-236 | None |
| A0A100IN41 | 393-535 | None |
| I7ZZH7 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.