DPCstruct | MC11310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 196 ± 28 aa |
| Standard deviation of domain lengths | 28.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2X2M5 | 3-139 | MQETPEWGIEVHGPTDNLFRITVVALEFAQREQQGFGHRFLWYANISFRLDGLFYVIAQLQERVSGSLAYRAWACIEKAYGYHQDLS… |
| A0A2H3IGL3 | 19-212 | HPSQQHDTEDSGRTGDVLNWSVKMVEYDVLGQSTELLRNFSWHLNAYFQLDAFVFMLIVLQSENPGLPLVDKAWDLVSETYKYRQSL… |
| A0A0J9VTB7 | 1-225 | None |
| A0A0G4KNU2 | 111-295 | None |
| A0A0G4KUL4 | 102-351 | None |
| A0A5N6TF24 | 9-187 | None |
| A0A0G2E4Q2 | 345-530 | None |
| A0A507R3Z5 | 500-699 | None |
| L2FYQ7 | 66-230 | None |
| V9DKS1 | 841-1048 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.