DPCstruct | MC11309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 536 ± 60 aa |
| Standard deviation of domain lengths | 59.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084G9L5 | 1-568 | MAELTVGYAAGIIAFGVVVAQLLLPTALSLFLVGVLRDQESAASWTAAGKVLQSSYWPTILRSDATHNHGVRKPIMFAVLAIPLIAI… |
| A0A2H3IAY0 | 1-628 | MAPSLQDLTVSDVSGMIAAAIAAALTLSAVTWSVLARELQSSYWPSILRTDSSTTSGVLKSVSIVSWSKTIAKLLTAIAAVVTPLGL… |
| A0A080WHD2 | 1-428 | None |
| A0A6A6ZE52 | 1-571 | None |
| A0A401L5X3 | 317-838 | None |
| A0A162NJG8 | 4-434 | None |
| F2SQI9 | 1-525 | None |
| A0A0S7DZR8 | 201-765 | None |
| A0A1S9DJT4 | 341-902 | None |
| A0A2U3EEI5 | 373-953 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.