DPCstruct | MC11308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9BPV9 | 9-109 | VVPVSKEEVGRWNERIWKMCNKLAEVLSEKNIRYNNSVFSPLGIFSTLTPLEGAKIRLDDKLKRIIAMTAGMSDDKEDAVFDLMGYL… |
| A0A1V5IU66 | 2-88 | LDEVLAEIRELLLSKNASYGNSALQPIGIFARGNSIEQIDVRIDDKLNRIKNGHEFHGEDTIKDLIGYLILRLVVTKILDDEVTKKD |
| A0A847YV67 | 75-159 | None |
| A0A1E7HR08 | 1-84 | None |
| A0A843GTR1 | 87-175 | None |
| A0A3L6ZTI9 | 166-247 | None |
| A0A7S9RBY1 | 3-84 | None |
| A0A0P0DMP6 | 2-71 | None |
| A0A350P1M8 | 3-95 | None |
| A0A382SB59 | 111-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.