DPCstruct | MC11306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5IEZ1 | 6-87 | FITIRGRMTTAAQYMTAHAKTRASERYNVSLNRDHYWKLVRLIQRGRAQFIQRTSNTRTVWRVDGMVAVYSSRHKRIVTFLP |
| A0A519GCH1 | 4-77 | AERSHTKLRLAERYGLTVSSAEIFHMAKLIAHGRATFVARQSRHVGKWLLAYQGHTLHLVFDSQRRSIITALPP |
| A0A511XKU2 | 3-84 | None |
| A0A7C9M6Z1 | 8-106 | None |
| A0A7C9LP68 | 18-106 | None |
| A0A2S0KSP4 | 2-83 | None |
| A0A1Y5FAE8 | 6-93 | None |
| A0A7V2H7H3 | 3-80 | None |
| Q2W3Q9 | 1-75 | None |
| A0A1F6RAE5 | 16-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.